AMAB90784

Sigma-Aldrich

Monoclonal Anti-ATRX antibody produced in mouse

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL0537, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(s):
XNP, RAD54, XH2, JMS

Quality Level

biological source

mouse

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

CL0537, monoclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

application(s)

immunoblotting: 1 μg/mL
immunofluorescence: 2-10 μg/mL
immunohistochemistry: 1:200- 1:500

isotype

IgG1

conjugate

unconjugated

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... ATRX(546)

General description

ATRX (α-thalassemia/mental retardation syndrome X-linked) is encoded by the gene mapped to human chromosome Xq21.1. The encoded protein belongs to SWI/SNF (SWItch/sucrose non-fermentable) family of chromatin remodeling proteins.

Immunogen

alpha thalassemia/mental retardation syndrome X-linked, recombinant protein epitope signature tag (PrEST)

Sequence

AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR

Biochem/physiol Actions

ATRX (α-thalassemia/mental retardation syndrome X-linked) is involved in the H3.3-ATRX-DAXX chromatin-remodeling pathway. It plays a vital role in assimilation of the histone variant H3.3 at pericentric heterochromatin and at telomeres, as well as at several transcription factor binding sites. Mutation in the gene has been observed in various types of gliomas. Thus, this protein can be considered as a potential biomarker for gliomas. In addition, aberrations in the gene expression leads to characteristic developmental abnormalities, such as severe mental retardation, facial dysmorphism, urogenital abnormalities and α-thalassemia.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74299.

Physical form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
Clinical Neuropathology practice news 2-2014: ATRX, a new candidate biomarker in gliomas
Haberler C and Adelheid W
Clinical Neuropathology, 33(2), 108?111-108?111 (2014)
Co-inheritance of novel ATRX gene mutation and globin (α & β) gene mutations in transfusion dependent beta-thalassemia patients.
Al-Nafie A N, et al.
Blood Cells, Molecules and Diseases, 55(1), 27-29 (2015)
Concomitant microduplications of MECP2 and ATRX in male patients with severe mental retardation
Honda S, et al.
Journal of Human Genetics, 57(1), 73?77-73?77 (2012)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.