All Photos(1)

AV01043

Sigma-Aldrich

Anti-CRKL antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-v-crk sarcoma virus CT10 oncogene homolog (avian)-like
NACRES:
NA.41

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

34 kDa

species reactivity

bovine, canine, human, rat, mouse

concentration

0.5 mg - 1 mg/mL

application(s)

western blot: suitable

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... CRKL(1399)

General description

CRKL is a CRK-like protein that activates RAS an Jun kinase signaling pathways.
CRKL is an adaptor protein that associates with several signaling molecules such as c-ABL, PI3-K, SOS, C3G and SOS. Furthermore, CRKL has been implicated in hematopoietic and leukemic signaling pathways.
Rabbit Anti-CRKL antibody associates with canine, human, mouse, and rat CRKL.

Immunogen

The immunogen for anti-CRKL antibody: synthetic peptide derected towards the middle region of human CRKL

Application

Rabbit Anti-CRKL antibody can be used for western blot (2μg/ml) assays.

Sequence

Synthetic peptide located within the following region: RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certificate of Analysis

Certificate of Origin

M Sattler et al.
Leukemia, 12(5), 637-644 (1998-05-21)
CRKL is a 39 kDa adapter protein, originally cloned in proximity to the BCR gene on chromosome 22, which has a key regulatory role in hematopoietic cells. CRKL has one SH2 and two SH3 domains, with 60% homology to CRK...
Sarah Brown et al.
European journal of haematology, 93(2), 96-102 (2014-03-13)
Mature dendritic cells (DCs) may be derived from the BCR/ABL1 expressing monocytes in chronic myeloid leukaemia. These cells have potential therapeutic applications, but are recognised to have defective function. In normal DCs, activation and maturation depend on ABL1 dependent signals....

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service