All Photos(1)

AV30042

Sigma-Aldrich

Anti-KLF11 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):
Anti-Kruppel-like factor 11
NACRES:
NA.41

biological source

rabbit

Quality Level

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

55 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

application(s)

western blot: suitable

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... KLF11(8462)

Immunogen

Synthetic peptide directed towards the N terminal region of human KLF11

Application

Anti-KLF11 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.

Biochem/physiol Actions

KLF11 belongs to KLF family of transcription factors that regulate GC promoters and important metabolic processes in diverse organisms. The histone acetyltransferase pathways mediated by KLF11 affect the regulation of insulin in neonatal diabetes. KLF11 mediates increase in basal insulin levels and glucose-stimulated insulin secretion. It suppresses inflammatory activation of endothelial cells by inhibition of NF-κB pathway that results in downregulation of VCAM-1 and E-selectin promoters.

Sequence

Synthetic peptide located within the following region: SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Yanbo Fan et al.
Arteriosclerosis, thrombosis, and vascular biology, 32(12), 2981-2988 (2012-10-09)
Endothelial cell (EC) inflammatory status is critical to many vascular diseases. Emerging data demonstrate that mutations of Krüppel-like factor-11 (KLF11), a gene coding maturity-onset diabetes mellitus of the young type 7 (MODY7), contribute to the development of neonatal diabetes mellitus....
Gwen Lomberk et al.
The Journal of biological chemistry, 288(24), 17745-17758 (2013-04-17)
The function of Krüppel-like factor 11 (KLF11) in the regulation of metabolic pathways is conserved from flies to human. Alterations in KLF11 function result in maturity onset diabetes of the young 7 (MODY7) and neonatal diabetes; however, the mechanisms underlying...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service