MilliporeSigma
All Photos(3)

AV30103

Sigma-Aldrich

Anti-RBM10 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):
Anti-RNA binding motif protein 10
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

104 kDa

species reactivity

guinea pig, human, dog, bovine, rat, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... RBM10(8241)

General description

The RNA Binding Motif 10 (RBM10) is similar to RBM5 and functions as a modulator of apoptosis. RBM10 can also act as an RNA binding protein and regulate the co-transcriptional modification of pre-mRNA.
Rabbit Anti-RBM10 (AB1) antibody recognizes canine, mouse, rat, and human RBM10.

Immunogen

Synthetic peptide directed towards the N terminal region of human RBM10

Application

Rabbit Anti-RBM10 (AB1) antibody can be used for western blot (1.4μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissues) applications.

Biochem/physiol Actions

RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3′ end lies within 20 kb upstream of UBE1.

Sequence

Synthetic peptide located within the following region: MDYRSYPREYGSQEGKHDYDDSSEEQSAEDSYEASPGSETQRRRRRRHRH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service