All Photos(1)

AV31493

Sigma-Aldrich

Anti-KLF1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-EKLF, Anti-Kruppel-like factor 1 (erythroid)
NACRES:
NA.41

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

38 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

application(s)

western blot: suitable

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... KLF1(10661)

General description

KFL1 is known to modulate BCL11A expression and can increase human γ-globin/β-globin expression ratios. Furthermore, KFL1 haploinsufficiency can cause hereditary persistence of fetal hemoglobin.
Rabbit Anti-KLF1 antibody recognizes bovine, pig, human, mouse, and rat KLF1.

Immunogen

Synthetic peptide directed towards the middle region of human KLF1

Application

Rabbit Anti-KLF1 antibody can be used for western blot assays at 1μg/ml.

Biochem/physiol Actions

KLF1 is a transcription factor, originally identified in this laboratory, which plays a crucial role as a transcriptional activator at the adult beta-globin locus.

Sequence

Synthetic peptide located within the following region: PKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Joseph Borg et al.
Nature genetics, 42(9), 801-805 (2010-08-03)
Hereditary persistence of fetal hemoglobin (HPFH) is characterized by persistent high levels of fetal hemoglobin (HbF) in adults. Several contributory factors, both genetic and environmental, have been identified but others remain elusive. HPFH was found in 10 of 27 members...
Dewang Zhou et al.
Nature genetics, 42(9), 742-744 (2010-08-03)
We show that knockdown of KLF1 in human and mouse adult erythroid progenitors markedly reduces BCL11A levels and increases human gamma-globin/beta-globin expression ratios. These results suggest that KLF1 controls globin gene switching by directly activating beta-globin and indirectly repressing gamma-globin...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service