MilliporeSigma
All Photos(2)

AV32329

Sigma-Aldrich

Anti-BMP7 antibody produced in rabbit

IgG fraction of antiserum, lyophilized powder

Synonym(s):
Anti-Bone morphogenetic protein 7 (osteogenic protein 1), Anti-OP-1

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

clone

polyclonal

form

lyophilized powder

mol wt

49 kDa

species reactivity

human, canine, chicken, pig, bovine, rabbit, zebrafish, mouse, rat

technique(s)

immunohistochemistry: suitable
western blot: suitable

immunogen sequence

LQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASL

NCBI accession no.

storage temp.

−20°C

Gene Information

human ... BMP7(655)

General description

Bone morphogenetic protein 7 (BMP7, osteogenic protein 1) is a cell signaling protein involved in the transformation of mesenchymal cells into bone and cartilage, and regulates bone homeostasis. BMP7 induces the activation of signaling molecules SMAD1 and SMAD5 which induce various osteogenic genes. BMP7 is a ventralization factor involved in the determination of ventral-dorsal organization during morphogenesis.
Rabbit polyclonal anti-BMP-7 antibody reacts with a zebrafish, human, mouse, rat, chicken, canine, rabbit, bovine, and pig bone morphogenetic protein 7 proteins.

Immunogen

synthetic peptide corresponding to a region of human BMP7 with an internal ID of P03316

Application

Rabbit Anti-BMP7 antibody can be used for western blot assays at a concentration of 1.25μg/ml. It can also be used for IHC at 4-8μg/ml using paraffin-embedded tissues.
Rabbit polyclonal anti-BMP-7 antibody is used to tag bone morphogenetic protein 7 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of bone morphogenetic protein 7 in osteogenesis and the process of ventralization during morphogenesis.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service