AV34318

Sigma-Aldrich

Anti-CNOT3 antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-CCR4-NOT transcription complex, subunit 3
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

82 kDa

species reactivity

horse, rat, dog, bovine, guinea pig, mouse, human, rabbit

concentration

0.5 mg - 1 mg/mL

application(s)

western blot: suitable

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... CNOT3(4849)

General description

CNOT3 is a subunit of the CCR4-NOT transcription complex. This subunit can bind to the PRPF31 promoter and mediate transcriptional repression. It acts as a modifier gene and controls the effects of PRPF31 mutations in retinitis pigmentosa. CNOT3 mutations have also been implicated in T-cell acute lymphoblastic leukemia (T-ALL).
Rabbit Anti-CNOT3 antibody recognizes bovine, human, mouse, rat, zebrafish, canine, and rabbit CNOT3.

Immunogen

Synthetic peptide directed towards the N terminal region of human CNOT3

Application

Rabbit Anti-CNOT3 antibody can be used for western blot applications at a concentration of 0.5 μg/ml.

Biochem/physiol Actions

CNOT3 is a protein component of CCR4-NOT protein complex. Yeast CCR$-NOT is a global regulator of RNA polymerase II transcription. It is comprised of yeast NOT1 to NOT5, yeast CCR4 and additional proteins like yeast CAF1.

Sequence

Synthetic peptide located within the following region: QFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRML

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
Kim De Keersmaecker et al.
Nature genetics, 45(2), 186-190 (2012-12-25)
T-cell acute lymphoblastic leukemia (T-ALL) is caused by the cooperation of multiple oncogenic lesions. We used exome sequencing on 67 T-ALLs to gain insight into the mutational spectrum in these leukemias. We detected protein-altering mutations in 508 genes, with an...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.