AV34506

Sigma-Aldrich

Anti-FHL2 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):
Anti-Four and a half LIM domains 2
NACRES:
NA.41

biological source

rabbit

Quality Level

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

32 kDa

species reactivity

human, mouse, rat, horse, dog

concentration

0.5 mg - 1 mg/mL

application(s)

immunohistochemistry: suitable
western blot: suitable

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... FHL2(2274)

General description

FHL2 is a four-and-a-half LIM domain protein that functions as tissue-specific co-activator of androgen receptor (AR). FHL2 is known to inhibit FOXO1 function in prostate cancer cells by SIRT1-mediated deacetylation.
Rabbit Anti-FHL2 antibody recognizes canine, human, mouse, rat, bovine, and zebrafish FHL2.

Immunogen

Synthetic peptide directed towards the C terminal region of human FHL2

Application

Rabbit Anti-FHL2 antibody is suitable for western blot (0.6 μg/ml) and IHC (4-8 μg/ml) applications.

Biochem/physiol Actions

FHL2 is a member of LIM proteins that contain a highly conserved double zinc finger motif called the LIM domain.

Sequence

Synthetic peptide located within the following region: RFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
J M Müller et al.
The EMBO journal, 19(3), 359-369 (2000-02-02)
The control of target gene expression by nuclear receptors requires the recruitment of multiple cofactors. However, the exact mechanisms by which nuclear receptor-cofactor interactions result in tissue-specific gene regulation are unclear. Here we characterize a novel tissue-specific coactivator for the...
Yonghua Yang et al.
The EMBO journal, 24(5), 1021-1032 (2005-02-05)
Forkhead box class O (FOXO) proteins are transcription factors that function downstream of the PTEN tumor suppressor and directly control the expression of genes involved in apoptosis, cell cycle progression, and stress responses. In the present study, we show that...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.