MilliporeSigma
All Photos(2)

AV34728

Sigma-Aldrich

Anti-KEAP1 antibody produced in rabbit

IgG fraction of antiserum, lyophilized powder

Synonym(s):
Anti-INrf2, Anti-KIAA0132, Anti-KLHL19, Anti-Kelch-like ECH-associated protein 1, Anti-MGC10630, Anti-MGC1114, Anti-MGC20887, Anti-MGC4407

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

70 kDa

species reactivity

human, rat, pig, zebrafish, bovine, canine, mouse

technique(s)

immunohistochemistry: suitable
western blot: suitable

immunogen sequence

ETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTD

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... KEAP1(9817)

General description

KEAP1 codes for a KELCH-1 like domain protein that interacts with NF-E2-related factor 2. KEPAP1 has been implicated in cell signaling pathways that regulate responses to environmental and oxidative stresses.
Rabbit Anti-KEAP1 antibody recognizes pig, zebrafish, canine, bovine, human, mouse, and rat KEAP1.

Immunogen

synthetic peptide corresponding to a region of human KEAP1 with an internal ID of P23660

Application

Rabbit Anti-KEAP1 antibody is suitable for western blot (1.0 μg/ml) and IHC (4-8 μg/ml) applications.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service