All Photos(1)

AV38662

Sigma-Aldrich

Anti-KLF10 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):
Anti-Kruppel-like factor 10
NACRES:
NA.41

biological source

rabbit

Quality Level

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

53 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

application(s)

western blot: suitable

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... KLF10(7071)

Immunogen

Synthetic peptide directed towards the N terminal region of human KLF10

Biochem/physiol Actions

Krüppel -like factor 10 (KLF10) belongs to family of Krüppel-like zinc finger proteins characterized by C2H2-type zinc finger domains. KLF10 is a transcriptional repressor that affects TGF-β1 signaling pathway and regulates differentiation and neovascularization of bone marrow-derived proangiogenic cells. It acts as a prognostic factor for pancreatic adenocarcinoma.

Sequence

Synthetic peptide located within the following region: MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Beth B McConnell et al.
Physiological reviews, 90(4), 1337-1381 (2010-10-21)
The Krüppel-like factor (KLF) family of transcription factors regulates diverse biological processes that include proliferation, differentiation, growth, development, survival, and responses to external stress. Seventeen mammalian KLFs have been identified, and numerous studies have been published that describe their basic...
Vincent H S Chang et al.
The American journal of pathology, 181(2), 423-430 (2012-06-13)
Deregulation of transforming growth factor (TGF)-β function is a common feature of pancreatic cancer, rendering these cancers unresponsive to TGF-β-stimulated growth inhibition. Recent findings have supported a primary role for Krüppel-like factor 10 (KLF10) as an important transcription factor involved...
Akm Khyrul Wara et al.
Blood, 118(24), 6450-6460 (2011-08-11)
Emerging evidence demonstrates that proangiogenic cells (PACs) originate from the BM and are capable of being recruited to sites of ischemic injury where they contribute to neovascularization. We previously determined that among hematopoietic progenitor stem cells, common myeloid progenitors (CMPs)...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service