MilliporeSigma
All Photos(3)

AV38981

Sigma-Aldrich

Anti-KEAP1 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-Kelch-like ECH-associated protein 1
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

70 kDa

species reactivity

guinea pig, human, rat, rabbit, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... KEAP1(9817)

Immunogen

Synthetic peptide directed towards the C terminal region of human KEAP1

Biochem/physiol Actions

KEAP1 (Kelch-like ECH-associated protein 1) is an adaptor protein that represses Nrf2-mediated transcription. The KEAP1/Nrf2 axis regulates the ROS signaling and has important role in osteoclast differentiation and expression of antioxidant enzymes. Aberrant methylation of KEAP1 gene has been reported in breast cancer and may contribute to the cancer progression.

Sequence

Synthetic peptide located within the following region: HTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service