MilliporeSigma
All Photos(1)

AV41154

Sigma-Aldrich

Anti-RBM45 antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-DRB1, Anti-FLJ44612, Anti-RNA binding motif protein 45

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

53 kDa

species reactivity

mouse, guinea pig, human, horse, bovine, rat, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... RBM45(129831)

General description

RNA binding motif protein 45 (RBM45, DRB1) is a member of the neural RNA recognition motif (RRM)-type neural RNA-binding protein involved in essential roles in neural development. DRB1 possesses a binding preference for poly(C)RNA.

Specificity

Anti-RBM45 polyclonal antibody reacts with rat, bovine, human, mouse, rat, and human RNA binding motif protein 45 proteins.

Immunogen

The immunogen for anti-RBM45 antibody: synthetic peptide derected towards the middle region of human RBM45

Application

Anti-RBM45 polyclonal antibody is used to tag RNA binding motif protein 45 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles RNA binding motif protein 45 in poly(C)RNA binding and neural development.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

Sequence

Synthetic peptide located within the following region: MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service