MilliporeSigma
All Photos(1)

AV43515

Sigma-Aldrich

Anti-STEAP3 (AB1) antibody produced in rabbit

affinity isolated antibody, lyophilized powder

Synonym(s):
Anti-Dudlin-2, Anti-STEAP family member 3, Anti-STMP3, Anti-TSAP6

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

56 kDa

species reactivity

rat, mouse, horse, human, rabbit

technique(s)

western blot: suitable

immunogen sequence

SSLGFVALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILA

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... STEAP3(55240)

Immunogen

synthetic peptide corresponding to a region of human STEAP3 with an internal ID of Y01350

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service