MilliporeSigma
All Photos(2)

AV44430

Sigma-Aldrich

Anti-GPR177 antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-C1orf139, Anti-EVI, Anti-FLJ23091, Anti-G protein-coupled receptor 177, Anti-MGC131760, Anti-MGC14878, Anti-MRP, Anti-RP11-518D3.2

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

52 kDa

species reactivity

rat, bovine, canine, human, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

storage temp.

−20°C

Gene Information

human ... GPR177(79971)

General description

G protein-coupled receptor 177 (Evi/Gpr177), a Wnt trafficking regulator, is a multipass transmembrane protein that regulates the sorting and secretion of Wnt protein. Evi/Gpr177 is required for organogenesis during embryogenesis and for the establishment of the anterior-posterior axis. Evi/Gpr177 promotes various cancers such as glioma tumourigenesis.

Specificity

Anti-GPR177 polyclonal antibody reacts with bovine, rat, human, mouse, and canine G protein-coupled receptor 177 proteins.

Immunogen

The immunogen for anti-GPR177 antibody: synthetic peptide derected towards the N terminal of human GPR177

Application

Anti-GPR177 polyclonal antibody is used to tag glutathione G protein-coupled receptor 177 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to study the role of G protein-coupled receptor 177 in Wnt signaling, embryogenesis and cancer progression.

Sequence

Synthetic peptide located within the following region: ARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHME

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service