

Anti-LFNG antibody produced in rabbit

affinity isolated antibody

Anti-SCDO3, Anti-LFNG O-fucosylpeptide 3-β-N-acetylglucosaminyltransferase

biological source


Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies




buffered aqueous solution

mol wt

39 kDa

species reactivity

horse, rat, yeast, human, mouse, guinea pig


0.5 mg - 1 mg/mL


western blot: suitable



NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.


Gene Information

human ... LFNG(3955)


Synthetic peptide directed towards the N terminal region of human LFNG


Anti-LFNG antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (LFNG) is a member of the fringe family of glycotransferases and Golgi membrane protein that might also be secreted. The members of the fringe family participate in the Notch signaling pathway to regulate embryonic development. Mutations in LFNG gene are associated with spondylocostal dysostosis while duplication of a part of the gene has been reported in Asperger syndrome.


Synthetic peptide located within the following region: LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


NONH for all modes of transport

WGK Germany


Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
A T Vulto-van Silfhout et al.
Molecular syndromology, 2(6), 245-250 (2012-07-24)
De novo genomic aberrations are considered an important cause of autism spectrum disorders. We describe a de novo 380-kb gain in band p22.3 of chromosome 7 in a patient with Asperger syndrome. This duplicated region contains 9 genes including the...
Sally L Dunwoodie
Biochimica et biophysica acta, 1792(2), 100-111 (2008-12-09)
Notch signaling is an evolutionarily conserved mechanism that determines cell fate in a variety of contexts during development. This is achieved through different modes of action that are context dependent. One mode involves boundary formation between two groups of cells....
S H Johnston et al.
Development (Cambridge, England), 124(11), 2245-2254 (1997-06-01)
The formation of boundaries between groups of cells is a universal feature of metazoan development. Drosophila fringe modulates the activation of the Notch signal transduction pathway at the dorsal-ventral boundary of the wing imaginal disc. Three mammalian fringe-related family members...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon


Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.