MilliporeSigma
All Photos(2)

AV45734

Sigma-Aldrich

Anti-SGPP2 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):
Anti-FLJ39004, Anti-SPP2, Anti-Sphingosine-1-phosphate phosphotase 2

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

37 kDa

species reactivity

horse, guinea pig, human, mouse, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... SGPP2(130367)

General description

Sphingosine-1-phosphate phosphotase 2 (SGPP2, SPP2), a lipid phosphohydrolase (SPP) family member, is active against the bioactive lipids, sphingosine 1-phosphate (S1P) and dihydrosphingosine 1-phosphate. SGPP2 is an attenuator of S1P signaling and a potential mediator of pro-inflammatory signaling.

Specificity

Anti-SGPP2 polyclonal antibody reacts with human and mouse sphingosine-1-phosphate phosphotase 2 proteins.

Immunogen

The immunogen for anti-SGPP2 antibody: synthetic peptide derected towards the C terminal of human SGPP2

Application

Anti-SGPP2 polyclonal antibody is used to tag sphingosine-1-phosphate phosphotase 2 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of sphingosine-1-phosphate phosphotase 2 in inflammation and S1P signaling.

Sequence

Synthetic peptide located within the following region: SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service