AV46049

Sigma-Aldrich

Anti-PAICS antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-MGC1343, Anti-Phosphoribosylaminoimidazole succinocarboxamide synthetase, Anti-DKFZp781N1372, Anti-PAIS, Anti-MGC5024, Anti-ADE2, Anti-ADE2H1, Anti-AIRC
NACRES:
NA.41

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

47 kDa

species reactivity

horse, dog, human, mouse, rabbit, bovine, guinea pig

concentration

0.5 mg - 1 mg/mL

application(s)

western blot: suitable

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... PAICS(10606)

General description

Phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS, ADE2H1, AIRC, PAIS) is a bifunctional enzyme involved in de novo purine (adenine, quanine) biosynthesis in vertebrates. PAICS is an important enzyme in rapidly growing tumor cells that rely on de novo purine synthesis. PAICS has both 5-aminoimidazole ribonucleotide carboxylase (AIRc) and 4-(N-succinylcarboxamide)-5-aminoimidazole ribonucleotide synthetase (SAICARs) activities and is a target for potential anticancer drugs.

Specificity

Anti-PAICS polyclonal antibody reacts with chicken, bovine, human, mouse, and rat phosphoribosylaminoimidazole succinocarboxamide synthetases.

Immunogen

Synthetic peptide directed towards the N terminal region of human PAICS

Application

Anti-PAICS polyclonal antibody is used to tag phosphoribosylaminoimidazole succinocarboxamide synthetase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of phosphoribosylaminoimidazole succinocarboxamide synthetase in purine biosynthesis and cancer cell survival.

Biochem/physiol Actions

PAICS is a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. This gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. The gene is closely linked and divergently transcribed with a locus that encodes an enzyme in the same pathway, and transcription of the two genes is coordinately regulated. The human genome contains several pseudogenes of this gene. Multiple transcript variants encoding different isoforms have been found for this gene.

Sequence

Synthetic peptide located within the following region: ATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

storage_class_code

12 - Non Combustible Liquids

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service