MilliporeSigma
All Photos(1)

AV47220

Sigma-Aldrich

Anti-A4GNT (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-α-1,4-N-Acetylglucosaminyltransferase, Anti-α4GnT, Anti-MGC149493
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

39 kDa

species reactivity

human, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... A4GNT(51146)

Immunogen

Synthetic peptide directed towards the N terminal region of human A4GNT

Application

Anti-A4GNT (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

A4GNT (α-1,4-N-acetylglucosaminyltransferase) gene encodes an enzyme that belongs to glycosyltransferase 32 family and is expressed predominantly in stomach and pancreas, as well as in gastric cancer cells. A4GNT facilitates the biosynthesis of mucin type glycoprotein (O-glycan). It also mediates the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans with α1,4-linkage, forming GlcNAcα1,4Galβ residues. Further, α4GnT mRNA expressed in mononuclear cell fraction of peripheral blood acts as a biomarker for pancreatic cancer.

Sequence

Synthetic peptide located within the following region: LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service