AV48945

Sigma-Aldrich

Anti-QTRT1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-Queuine tRNA-ribosyltransferase 1 (tRNA-guanine transglycosylase), Anti-TGT, Anti-FP3235
NACRES:
NA.41

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

44 kDa

species reactivity

mouse, dog, rat, horse, rabbit, human

concentration

0.5 mg - 1 mg/mL

application(s)

western blot: suitable

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... QTRT1(81890)

Immunogen

Synthetic peptide directed towards the N terminal region of human QTRT1

Application

Anti-QTRT1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Biochem/physiol Actions

Queuine tRNA-ribosyltransferase 1 (QTRT1) is the catalytic subunit of tRNA-guanine transglycosylase that is important for the synthesis of 7-deazaguanosine queuosine. This modification is found in tRNA that code for asparagine, aspartic acid, histidine and tyrosine.

Sequence

Synthetic peptide located within the following region: FMPVGTQATMKGITTEQLDALGCRICLGNTYHLGLRPGPELIQKANGLHG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

storage_class_code

12 - Non Combustible Liquids

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Yi-Chen Chen et al.
RNA (New York, N.Y.), 16(5), 958-968 (2010-04-01)
The eukaryotic tRNA-guanine transglycosylase (TGT) has been reported to exist as a heterodimer, in contrast to the homodimeric eubacterial TGT. While ubiquitin-specific protease 14 (USP14) has been proposed to act as a regulatory subunit of the eukaryotic TGT, the mouse...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service