All Photos(1)



Anti-CACYBP antibody produced in rabbit

IgG fraction of antiserum

Anti-Calcyclin binding protein, Anti-GIG5, Anti-MGC87971, Anti-PNAS-107, Anti-RP1-102G20.6, Anti-S100A6BP, Anti-SIP

biological source


Quality Level



antibody form

IgG fraction of antiserum

antibody product type

primary antibodies




buffered aqueous solution

mol wt

26 kDa

species reactivity

human, dog, rabbit, horse, bovine, pig


0.5 mg - 1 mg/mL


western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.


Gene Information

human ... CACYBP(27101)


Synthetic peptide directed towards the middle region of human CACYBP


Anti-CACYBP antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.

Biochem/physiol Actions

Calcyclin binding protein (CACYBP) is a calcyclin-binding protein involved in calcium-dependent ubiquitination and proteasomal degradation of target proteins. It has a role in the proteasomal degradation of beta-catenin. Dysregulation of CACYBP has been reported in glioma, gastric and pancreatic cancer.


Synthetic peptide located within the following region: FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids



Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service