HPA002636

Sigma-Aldrich

Anti-AURKA antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-hARK1, Anti-Aurora kinase A, Anti-Breast tumor-amplified kinase, Anti-Serine/threonine kinase 15, Anti-Aurora/IPL1-related kinase 1, Anti-Aurora-related kinase 1, Anti-Serine/threonine-protein kinase 6, Anti-Aurora-A
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

application(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYL

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... AURKA(6790)

Related Categories

General description

AURKA (aurora kinase A) is a centrosome-associated serine/threonine kinase which is associated with cell cycle checkpoint. It exhibits an inductive effect on the centrosome duplication-distribution abnormalities and aneuploidy in mammalian cells.

Immunogen

Serine/threonine-protein kinase 6 recombinant protein epitope signature tag (PrEST)

Application

Anti-AURKA antibody produced in rabbit has been used in immunohistochemistry and immunoblotting.

Biochem/physiol Actions

All the members of aurora family kinase play a pivotal role in the execution of cell division by participating in the formation of bipolar mitotic spindle, accurate segregation of chromosomes and the completion of cytokinesis. In mammals, AURKA (aurora kinase A) overexpression shows different chromosomal abnormalities, such as centrosome amplification, chromosomal transformation and instability. It helps in increasing centrosomal γ-tubulin and two other PCM (pericentriolar material) components, ZYG-9 (zygote defective protein 9) and Ce-Grip during entry of embryos into mitosis stage. AURKA is overexpressed in breast tumor cells and may associate with the oncogenic transformation. It has been reported that AURKA has clinical relationship with non-Hodgkin′s lymphoma as it is involved not only in disease activity but also in tumorigenesis of the disease.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86425.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
E Hannak et al.
The Journal of cell biology, 155(7), 1109-1116 (2001-12-19)
Centrosomes mature as cells enter mitosis, accumulating gamma-tubulin and other pericentriolar material (PCM) components. This occurs concomitant with an increase in the number of centrosomally organized microtubules (MTs). Here, we use RNA-mediated interference (RNAi) to examine the role of the...
Aurora kinase A is a prognostic marker in colorectal adenocarcinoma
Koh HM, et al.
Journal of pathology and translational medicine, 51(1), 32-32 (2017)
Clinicopathologic significance of Aurora kinase A expression in non-small cell lung cancer.
Lee
Basic and Applied Pathology, 5(1), 8-14 (2012)
H Zhou et al.
Nature genetics, 20(2), 189-193 (1998-10-15)
The centrosomes are thought to maintain genomic stability through the establishment of bipolar spindles during cell division, ensuring equal segregation of replicated chromosomes to two daughter cells. Deregulated duplication and distribution of centrosomes have been implicated in chromosome segregation abnormalities...
Khyati N Shah et al.
Nature medicine, 25(1), 111-118 (2018-11-28)
Although targeted therapies often elicit profound initial patient responses, these effects are transient due to residual disease leading to acquired resistance. How tumors transition between drug responsiveness, tolerance and resistance, especially in the absence of preexisting subclones, remains unclear. In...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.