All Photos(2)

HPA010953

Sigma-Aldrich

Anti-WFIKKN2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-WFIKKNRP, Anti-WFDC20B
Human Protein Atlas Number:

biological source

rabbit

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

application(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: suitable

immunogen sequence

GNGNNFESREACEESCPFPRGNQRCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDSGRALVTVDEVLKDEKMGLKFLGQEPLEVTLLHVDWACPCPNVTVSEMPLIIMGEVDGGMAMLRPDSFVGASSARRVRKLREVMHKKTC

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

General description

WFIKKN2 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2) is a transforming growth factor β (TGFβ) antagonist which binds with high affinity to GDF8/myostatin (growth and differentiation factor 8) and GDF11 (BMP11). This protein is an extracellular, large and mutlidomain protein. It consists of a WAP (Whey Acidic Protein) domain, a Follistatin/Kazal domain, an immunoglobulin domain, two Kunitz-type protease inhibitor domains and a (Netrin-like) NTR domain. It is expressed in brain, lung, pancreas, ovaries and testis. WFIKKN2 is not expressed in heart, liver, spleen, prostate, small intestine, colon, placenta and leukocyte. In fetus, it is expressed predominantly in the brain, thymus, kidney and skeletal muscle.

Immunogen

WAP, kazal, immunoglobulin, kunitz and NTR domain-containing protein 2 precursor recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Anti-WFIKKN2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

WFIKKN2 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2) is a serum protein that modulates muscle development by interacting with myostatin. It interacts with growth factors such as transforming growth factor β (TGFβ), bone morphogenetic protein 2 (BMP2) and BMP4, but does not affect their signaling pathway. It might instead, aid in maintaining their action localization to create growth factor gradients in the extracellular area. WFIKKN2 acts as an antagonist of myostatin, and its up-regulation leads to an increase in the muscle mass, as in the case of male subjects undergoing resistance training.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72219.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Certificate of Analysis

Certificate of Origin

Katalin Kondás et al.
The Journal of biological chemistry, 283(35), 23677-23684 (2008-07-04)
WFIKKN1 and WFIKKN2 are large extracellular multidomain proteins consisting of a WAP, a follistatin, an immunoglobulin, two Kunitz-type protease inhibitor domains, and an NTR domain. Recent experiments have shown that WFIKKN2 protein binds mature GDF8/myostatin and myostatin propeptide and inhibits...
Olivier Monestier et al.
BMC genomics, 13, 541-541 (2012-10-11)
Myostatin, a member of the TGFβ superfamily, is well known as a potent and specific negative regulator of muscle growth. Targeting the myostatin signalling pathway may offer promising therapeutic strategies for the treatment of muscle-wasting disorders. In the last decade...
Caroline Brun et al.
Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology, 30(3), 791-804 (2012-08-08)
Growth and differentiation factor-associated serum protein-1 (GASP-1) is a secreted protein known to be capable of binding and inhibiting the activity of several TGF-beta family members, including myostatin. The present study was designed to characterize murine GASP-1 post-translational modifications and...
György Szláma et al.
The FEBS journal, 277(24), 5040-5050 (2010-11-09)
WFIKKN1 and WFIKKN2 are large extracellular multidomain proteins consisting of a WAP domain, a follistatin domain, an immunoglobulin domain, two Kunitz-type protease inhibitor domains and an NTR domain. Recent experiments have shown that both proteins have high affinity for growth...
A Saremi et al.
Molecular and cellular endocrinology, 317(1-2), 25-30 (2009-12-23)
Myostatin is a catabolic regulator of skeletal muscle mass. The purpose of this study was to determine the effect of resistance training for 8 weeks in conjunction with creatine supplementation on muscle strength, lean body mass, and serum levels of...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service