HPA013650

Sigma-Aldrich

Anti-MAGI2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2, Anti-Atrophin-1-interacting protein 1, Anti-Atrophin-1-interacting protein A, Anti-MAGI-2, Anti-Membrane-associated guanylate kinase inverted 2
MDL number:
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

application(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

AEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEEPDPLPDNWEMA

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... MAGI2(9863)

General description

The gene MAGI2 (membrane associated guanylate kinase, WW and PDZ domain containing 2) is mapped to human chromosome 7q21 and spans 1.4 megabases. It contains 21 exons encoding a 2410 amino acid protein that contains nine potential protein-protein interaction domains. These domains include one Guk (guanylate kinase-like) domain, two WW domains and six PDZ domains.

Immunogen

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

The gene MAGI2 (membrane associated guanylate kinase, WW and PDZ domain containing 2) encodes a scaffolding protein that functions in the assembly of epithelial tight junction enhancing epithelial integrity. It negatively regulates cell migration and proliferation via PTEN (phosphatase and tensin homolog), a protein involved in cell growth and apoptosis. It has been implicated in celiac disease and ulcerative colitis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72647.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Certificate of Analysis
Certificate of Origin
Genitourinary Pathology.
Laboratory investigation; a journal of technical methods and pathology, 96 Suppl 1, 212-272 (2016-01-28)
Genitourinary Pathology.
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc, 29 Suppl 2, 212-272 (2016-01-29)
Dermot P B McGovern et al.
Inflammatory bowel diseases, 15(1), 75-83 (2008-08-23)
Despite recent advances the majority of inflammatory bowel disease (IBD) susceptibility 'genes' remain undiscovered. Recent data suggest that autoimmune conditions may 'share' susceptibility loci. Epidemiological evidence indicates an association between celiac disease and IBD and both conditions demonstrate increased gut...
Agnieszka Bierzynska et al.
Journal of the American Society of Nephrology : JASN, 28(5), 1614-1621 (2016-12-10)
Steroid-resistant nephrotic syndrome (SRNS), a heterogeneous disorder of the renal glomerular filtration barrier, results in impairment of glomerular permselectivity. Inheritance of genetic SRNS may be autosomal dominant or recessive, with a subset of autosomal recessive SRNS presenting as congenital nephrotic...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.