HPA015257

Sigma-Aldrich

Anti-RIPK1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-Serine/threonine-protein kinase RIP, Anti-Receptor-interacting protein, Anti-Receptor-interacting serine/threonine-protein kinase 1, Anti-Cell death protein RIP
Human Protein Atlas Number:
Pricing and availability is not currently available.

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

application(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

KEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAV

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... RIPK1(8737)

General description

RIPK1 (receptor -interacting serine-threonine kinase 1) is a necroptosis regulatory protein. It is a serine-threonine kinase containing a death domain. It contains a kinase domain in its N-terminal, RIP homotypic interaction motif, and its C-terminal contains the death domain.
RIPK1 gene is located at 6p25.2 on the human chromosome.

Immunogen

Receptor-interacting serine/threonine-protein kinase 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-RIPK1 antibody produced in rabbit has been used in immunoblotting and immunohistochemistry.
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

RIPK1 (receptor -interacting serine-threonine kinase 1) acts as a signaling molecule in tumor necrosis factor α (TNFα)-induced necroptosis. Necrostatins interact with this protein, to inhibit necroptosis. When induced by TNFα, it forms a component of the prosurvival complex I, which also includes TRADD (TNFR1-associated DD-protein), TRAF2 (TNF receptor-associated factor 2), cIAP1 (cellular inhibitor of apoptosis protein-1), and cIAP2. It is overexpressed in human melanoma, and acts as an oncogene for the same. This up-regulation is achieved due to NF-κB and TNFα, and results in tumor growth and proliferation. It is also up-regulated in gallbladder cancer, and its suppression results in reduced tumor growth and proliferation. It is also up-regulated in glioblastomas, and this is related to malignancy, as well as poor prognosis in glioblastoma patients. In primary and metastatic osteosarcoma, an anti-tumor agent shikonin is capable of inducing cell death by activating RIPK1.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73493.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Single-nucleotide polymorphism rs17548629 in RIPK1 gene may be associated with lung cancer in a young and middle-aged Han Chinese population
Yang S, et al.
Cancer Cell International, 20, 1-11 (2020)
S M Fayaz et al.
Journal of computer-aided molecular design, 28(7), 779-794 (2014-07-02)
Programmed cell death has been a fascinating area of research since it throws new challenges and questions in spite of the tremendous ongoing research in this field. Recently, necroptosis, a programmed form of necrotic cell death, has been implicated in...
Yongrui Du et al.
Scientific reports, 8(1), 6166-6166 (2018-04-20)
Acetylcholine (ACh) in the ovary and its actions were linked to survival of human granulosa cells in vitro and improved fertility of rats in vivo. These effects were observed upon experimental blockage of the ACh-degrading enzyme (ACH esterase; ACHE), by...
Burkhard Hirsch et al.
Laboratory investigation; a journal of technical methods and pathology, 93(6), 677-689 (2013-04-03)
CD30, a member of the tumor necrosis factor receptor (TNFR) superfamily, is consistently expressed by tumor cells of anaplastic large-cell lymphoma (ALCL). CD30 stimulation induces massive caspase-dependent cell death of ALCL cells in case of canonical NFκB inhibition or proteasome...
Shimin Yang et al.
Cancer cell international, 20, 143-143 (2020-05-06)
Genetic biomarkers of lung cancer (LC) susceptibility may provide a basis for treatment and prevention. This study analyzed an association between SNPs (single nucleotide polymorphisms) in the complementary region of the 3'-UTR (3' untranslated region) of microRNAs of the gene...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.