HPA015485

Sigma-Aldrich

Anti-IL1RL2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-IL-1Rrp2, Anti-Interleukin-1 receptor-like 2 precursor, Anti-Interleukin-1 receptor-related protein 2, Anti-IL1R-rp2
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

application(s)

immunohistochemistry: 1:20-1:50

immunogen sequence

QAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQLGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNITFLEVKMEDYGLPFMCHAG

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... IL1RL2(8808)

General description

IL1RL2 (interleukin 1 receptor-like 2) forms a component of the IL-36 signaling complex, which also includes one of the three IL36 isoforms namely, IL36α, -β or -γ, and is a member of the IL-1 receptor family. Within human myelomonocytic lineage, it is exclusively expressed on dendritic cells (DCs). This gene is localized to human chromosome 2q12. It is composed of three immunoglobulin (Ig)-like domains, which make up the ligand-binding region. It spans the plasma membrane once, and contains a cytosolic region made of 29 amino acids.

Immunogen

Interleukin-1 receptor-like 2 precursor recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

IL1RL2 (interleukin 1 receptor-like 2) is involved in the maturation of monocyte-derived dendritic cells (MDDCs), when its expression is activated by IL-4, IL-1F8 or IL-1F9 cytokines. It also promotes the differentiation of Th1 (T-helper) cells, and thus, has an immunomodulatory role.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71821.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Shilla Mutamba et al.
European journal of immunology, 42(3), 607-617 (2011-12-07)
We report for the first time that expression of the novel IL-1 cytokine receptor IL-1Rrp2 (IL-1R6) is unique to DCs within the human myelomonocytic lineage. IL-1Rrp2 was expressed by monocyte-derived dendritic cells (MDDCs) which was dose-dependently increased by IL-4 and...
M Dale et al.
Genomics, 57(1), 177-179 (1999-04-07)
The family of interleukin-1 receptor-like genes currently has six known members. We have constructed a contig of 10 overlapping human PAC clones that covers 530 kb and includes five of the six family members. The termini of the contig were...
C J McMahan et al.
The EMBO journal, 10(10), 2821-2832 (1991-10-01)
cDNA clones corresponding to an Mr approximately 80,000 receptor (type I receptor) for interleukin-1 (IL-1) have been isolated previously by mammalian expression. Here, we report the use of an improved expression cloning method to isolate human and murine cDNA clones...
Frank L van de Veerdonk et al.
Proceedings of the National Academy of Sciences of the United States of America, 109(8), 3001-3005 (2012-02-09)
The functional role of IL-1 family member 10, recently renamed IL-38, remains unknown. In the present study we aimed to elucidate the biological function of IL-38 and to identify its receptor. Heat-killed Candida albicans was used to stimulate memory T-lymphocyte...
Silke Frey et al.
Annals of the rheumatic diseases, 72(9), 1569-1574 (2012-12-27)
Interleukin (IL)-36α is a recently described member of the IL-1 cytokine family with pro-inflammatory and clearly pathogenic properties in psoriasis. To determine the IL-36α expression in psoriatic arthritis (PsA) compared to rheumatoid arthritis (RA) and osteoarthritis (OA). Synovial tissues obtained...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.