HPA023310

Sigma-Aldrich

Anti-BAIAP2 antibody produced in rabbit

enhanced validation

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-Brain-specific angiogenesis inhibitor 1-associated protein 2, Anti-IRSp53/58, Anti-Insulin receptor substrate protein of 53 kDa, Anti-BAI-associated protein 2, Anti-Protein BAP2, Anti-BAI1-associated protein 2, Anti-IRS-58, Anti-FLAF3, Anti-IRSp53, Anti-Insulin receptor substrate p53
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human, rat

packaging

antibody small pack of 25 μL

enhanced validation

independent
Learn more about Antibody Enhanced Validation

application(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

WFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNP

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... BAIAP2(10458)

General description

The gene BAIAP2 (BAI1 associated protein 2) is mapped to human chromosome 17q25. The protein has an I-BAR (inverted Bin/amphiphysin/Rvs) domain, a partial Cdc42 (cell division cycle 42)/Rac (v-akt murine thymoma viral oncogene homolog 1) binding domain, Src homology-3 (SH3) domain and a PDZ (PSD95, Dlg1 and zo-1) domain.

Immunogen

Brain-specific angiogenesis inhibitor 1-associated protein 2 recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

BAIAP2 (BAI1 associated protein 2) interaction with CDC42 (cell division cycle 42) is needed for filopodia formation. It is also involved in neuronal growth cone guidance. Mutations in BAIAP2 are associated with attention-deficit hyperactivity disorder and autism. BAIAP2 also participates in emotional modulation of memory strength. It also regulates cell motility and mediates the coupling of actin- associated remodeling with Rho guanosine triphosphatase (GTPase) and kinase signaling pathways.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST75831.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Ai Mei Chou et al.
The Journal of biological chemistry, 289(35), 24383-24396 (2014-07-18)
Filopodia are dynamic actin-based structures that play roles in processes such as cell migration, wound healing, and axonal guidance. Cdc42 induces filopodial formation through IRSp53, an Inverse-Bin-Amphiphysins-Rvs (I-BAR) domain protein. Previous work from a number of laboratories has shown that...
Lu Liu et al.
Behavioral and brain functions : BBF, 9, 48-48 (2014-01-01)
Attention-deficit/hyperactivity disorder (ADHD) is a common chronic neurodevelopmental disorder with a high heritability. Much evidence of hemisphere asymmetry has been found for ADHD probands from behavioral level, electrophysiological level and brain morphology. One previous research has reported possible association between...
Gediminas Luksys et al.
PloS one, 9(1), e83707-e83707 (2014-01-07)
Memory performance is the result of many distinct mental processes, such as memory encoding, forgetting, and modulation of memory strength by emotional arousal. These processes, which are subserved by partly distinct molecular profiles, are not always amenable to direct observation....
Sara Bisi et al.
Nature communications, 11(1), 3516-3516 (2020-07-16)
It is unclear whether the establishment of apical-basal cell polarity during the generation of epithelial lumens requires molecules acting at the plasma membrane/actin interface. Here, we show that the I-BAR-containing IRSp53 protein controls lumen formation and the positioning of the...
Yangsik Kim et al.
Frontiers in cellular neuroscience, 14, 23-23 (2020-03-03)
IRSp53 (also known as BAIAP2) is an abundant excitatory postsynaptic scaffolding protein implicated in autism spectrum disorders (ASD), schizophrenia, and attention-deficit/hyperactivity disorder (ADHD). IRSp53 is expressed in different cell types across different brain regions, although it remains unclear how IRSp53...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.