All Photos(1)

HPA023480

Sigma-Aldrich

Anti-KL antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-Klotho
MDL number:
Human Protein Atlas Number:

biological source

rabbit

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

application(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

immunogen sequence

MTDITWLNSPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALKAHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFPGPETLERFCPEEFTVCTEC

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... KL(9365)

General description

The gene KL (klotho) encodes a protein that has homology to β-glucosidase enzymes. The gene is mapped to human chromosome 13q12. The gene transcript spans a length of 5.2kb. Alternative splicing leads to the generation of two forms, a transmembrane and a secreted form. The transmembrane protein contains 1014 amino acids.

Immunogen

Klotho Precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

The KL (klotho) gene is also referred to as an anti-aging gene as it encodes a senescence-related molecule. It regulates fibroblast growth factor (FGF) 23 signaling by functioning as a cofactor or coreceptor. It is involved in the activation of TRPV5 (transient receptor potential cation channel subfamily V member 5), an ion channel, by functioning as a glucuronidase. Klotho affects several intracellular signaling pathways, such as p53/p21, cAMP, protein kinase C (PKC) and Wnt signaling pathways. Mutations in this gene have been associated with premature aging-like phenotypes and shortened life span. Single nucleotide polymorphisms in this gene have been associated with priapism in sickle cell anaemia.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Certificate of Analysis

Certificate of Origin

Current understanding of klotho.
Wang Y and Sun Z
Ageing Research Reviews, 8, 43-51 (2009)
M Kuro-o et al.
Nature, 390(6655), 45-51 (1997-11-18)
A new gene, termed klotho, has been identified that is involved in the suppression of several ageing phenotypes. A defect in klotho gene expression in the mouse results in a syndrome that resembles human ageing, including a short lifespan, infertility...
Association of single nucleotide polymorphisms in klotho with priapism in sickle cell anaemia.
Nolan VG
British Journal of Haematology, 128, 266-272 (2005)
Klotho converts canonical FGF receptor into a specific receptor for FGF23.
Urakawa I
Nature, 444, 770-774 (2006)
Mutation of the mouse klotho gene leads to a syndrome resembling ageing.
Kuro-o M, et.al.
Nature, 390, 45-51 (1997)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service