All Photos(2)

SAB1400851

Sigma-Aldrich

Monoclonal Anti-SH3PX3 antibody produced in mouse

clone 3A1, purified immunoglobulin, buffered aqueous solution

Synonym(s):
Anti-MGC32065
NACRES:
NA.41

Quality Level

biological source

mouse

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3A1, monoclonal

form

buffered aqueous solution

species reactivity

human

application(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

conjugate

unconjugated

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... SH3PX3(257364)

Immunogen

SH3PX3 (NP_695003, 475 a.a. ~ 574 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMYDNL

Physical form

Solution in phosphate buffered saline, pH 7.4

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service