All Photos(1)

WH0000708M1

Sigma-Aldrich

Monoclonal Anti-C1QBP antibody produced in mouse

clone 1F3, purified immunoglobulin, buffered aqueous solution

Synonym(s):
Anti-HABP1, Anti-SF2p32, Anti-gC1QR, Anti-gC1qR, Anti-complement component 1, q subcomponent binding protein, Anti-GC1QBP, Anti-p32
MDL number:
NACRES:
NA.41

Quality Level

biological source

mouse

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1F3, monoclonal

form

buffered aqueous solution

species reactivity

human

application(s)

indirect ELISA: suitable

isotype

IgG1κ

conjugate

unconjugated

GenBank® accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... C1QBP(708)

General description

The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. (provided by RefSeq)

Immunogen

C1QBP (NP_001203.1, 173 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

Certificate of Analysis

Certificate of Origin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service