All Photos(4)

WH0008570M1

Sigma-Aldrich

Monoclonal Anti-KHSRP antibody produced in mouse

clone 4C10, purified immunoglobulin, buffered aqueous solution

Synonym(s):
Anti-KH-type splicing regulatory protein (FUSE binding protein 2), Anti-KSRP, Anti-FUBP2, Anti-FBP2, Anti-MGC99676
NACRES:
NA.41

Quality Level

biological source

mouse

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4C10, monoclonal

form

buffered aqueous solution

species reactivity

human

application(s)

immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

conjugate

unconjugated

GenBank® accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... KHSRP(8570)

Immunogen

KHSRP (NP_003676, 151 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIM

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Certificate of Analysis

Certificate of Origin

Gracjan Michlewski et al.
Nature structural & molecular biology, 17(8), 1011-1018 (2010-07-20)
The pluripotency-promoting proteins Lin28a and Lin28b act as post-transcriptional repressors of let-7 miRNA biogenesis in undifferentiated embryonic stem cells. The levels of mature let-7a differ substantially in cells lacking Lin28 expression, indicating the existence of additional mechanism(s) of post-transcriptional regulation....

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service