05-23-2005

Sigma-Aldrich

Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

A potent vasoconstrictor.

Synonym(s):
Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem, NPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
Empirical Formula (Hill Notation):
C189H285N55O57S
CAS Number:
Molecular Weight:
4271.68
MDL number:

storage conditions

-20C

Quality Level

assay

≥97% (HPLC)

form

lyophilized solid

manufacturer/tradename

Calbiochem®

storage condition

OK to freeze
desiccated

color

white to off-white

solubility

5% acetic acid: 1 mg/mL

shipped in

ambient

General description

A potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.

Biochem/physiol Actions

Product does not compete with ATP.
Cell permeable: no
Reversible: yes
Primary Target
A potent vasoconstrictor

Packaging

Yes

Warning

Toxicity: Harmful (C)

Sequence

H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂

Other Notes

Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
Wahlestedt, C., et al. 1993. Science259, 528.
Leibowitz, S.F. 1992. NeuroReport3, 1023.

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany
Certificate of Analysis
Certificate of Origin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.