MilliporeSigma
All Photos(1)

Documents

AG549

Sigma-Aldrich

α-synuclein 61-140, human

Sign Into View Organizational & Contract Pricing

eCl@ss:
32160702

biological source

human

Quality Level

assay

>95% (SDS-PAGE)

form

powder

mol wt

Mw 8,460 Da

manufacturer/tradename

Chemicon®

technique(s)

cell based assay: suitable

NCBI accession no.

UniProt accession no.

shipped in

dry ice

Gene Information

human ... SNCA(6622)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
S7820S1071MABN826
vibrant-m

AG549

α-synuclein 61-140, human

vibrant-m

S7820

α-Synuclein human

vibrant-m

S1071

α-Synuclein A53T human

technique(s)

cell based assay: suitable

technique(s)

-

technique(s)

-

technique(s)

electron microscopy: suitable, immunocytochemistry: suitable, immunofluorescence: suitable, immunohistochemistry: suitable (paraffin), western blot: suitable

biological source

human

biological source

-

biological source

-

biological source

mouse

NCBI accession no.

NM_000345.2, NM_007308.1

NCBI accession no.

-

NCBI accession no.

-

NCBI accession no.

NP_000336.1

shipped in

dry ice

shipped in

dry ice

shipped in

dry ice

shipped in

dry ice

Gene Information

human ... SNCA(6622)

Gene Information

human ... SNCA(6622)

Gene Information

human ... SNCA(6622)

Gene Information

human ... SNCA(6622)

General description

Alpha-synuclein is encoded by the SNCA gene (also known as NACP, PARK1) in human. There are two other known synuclein family members, beta- and gamma-synuclein. Interest in synuclein research started with the discovery of alpha-synuclein mutation in several families with autosomal dominant Parkinson′s disease (PD). Alpha-synuclein is abundantly expressed in the brain and is found in a classic amyloid fibril form within the intra-neuronal Lewy body deposits of PD. The physiological function of synucleins is not well understood, but appears to involve membrane interactions, and in particular reversible binding to synaptic vesicle membranes. Contradictory evidences regarding inhibitory action of alpha-synuclein against phospholipase D (PLD) have been reported (PMID 11821392 & 19146388). Clone Syn211, Cat. No. 36-008-C detects epitope in the region from amino acid 121 to 125 and has been used together with clone LB509, Cat. No. MABN824, to characterize the digestion pattern of different forms of in vitro prepared alpha-synclulein aggregates (Guo, J.L., et al. 2013; PMID 23827677).
MEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEE-
GAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
An additional amino acid (Met) is attached at the N-terminus.
Product Source: E. coli

Application

Research Category
Neuroscience
Research Sub Category
Neurodegenerative Diseases

Physical form

White lyophilized powder. Resuspend in sterile water at concentration of 1 mg/mL. This will give you a final of 20 mM Tris/HCI, pH 7.5, 100 mM NaCl.

Storage and Stability

Maintain lyophilized material at -20°C for up to 12 months after date of receipt. After reconstitution maintain at -20°C to -70°C for up to 2 weeks in undiluted aliquots. Avoid freeze/thaw cycles to avoid aggregation.

Legal Information

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

11 - Combustible Solids

wgk_germany

WGK 1


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service