MilliporeSigma
All Photos(2)

HPA006376

Sigma-Aldrich

Anti-TGFB1I1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-Androgen receptor coactivator ARA55 isoform 2 antibody produced in rabbit
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

rat, mouse, human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: suitable

immunogen sequence

AGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCGEPF

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... TGFB1I1(7041)

General description

TGFB1I1 (transforming growth factor β1 induced transcript 1) belongs to the focal adhesion adaptor protein family. It has a CArG element in its promoter region, and it shuttles between the cytoplasm and nucleus. It is closely related to paxilin protein, and they both are members of group III LIM domain family. It contains four leucine-rich motifs called LD motifs in its N-terminal, and seven zinc-finger domains. It localizes to nucleus as well as focal adhesions. This gene is localized to human chromosome 16p11.2.

Immunogen

Androgen receptor coactivator ARA55 isoform 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

TGFB1I1 (transforming growth factor β1 induced transcript 1) is an oncogene, which facilitates invasion by cancer cells, and participates in EMT (epithelial-mesenchymal transition). In TGF-β-treated MCF10A cells it facilitates invasion through modulation of p38 MAPK (mitogen activated protein kinase) by Rac1 (Ras-related C3 botulinum toxin substrate 1). It also promotes matrix degradation and cell migration. Through EMT transition, it promotes progression of astrocytomas, and thus, might have potential as a therapeutic target in the same.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70833.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service