MilliporeSigma
All Photos(4)

Documents

AMAB90791

Sigma-Aldrich

Monoclonal Anti-SLC22A2 antibody produced in mouse

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL0628, purified immunoglobulin, buffered aqueous glycerol solution

Sign Into View Organizational & Contract Pricing

Synonym(s):
OCT2

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

CL0628, monoclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:200- 1:500

isotype

IgG1

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SLC22A2(6582)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
AMAB90792SAB1402922SAB1400080
antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

species reactivity

human

species reactivity

human

species reactivity

human

species reactivity

human

clone

CL0628, monoclonal

clone

CL0631, monoclonal

clone

4B1, monoclonal

clone

3F6, monoclonal

biological source

mouse

biological source

mouse

biological source

mouse

biological source

mouse

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

Solute carrier family 22 member 2 (SLC22A2) also known as organic cation transporter 2 (OCT2), is expressed prominently in the basolateral membrane of epithelial cells of kidney, especially in the proximal renal tubule. SLC22A2 possess 12 transmembrane domains and is the integral plasma membrane protein. In the human, SLC22A2 gene is mapped to chromosome 6q26.

Immunogen

solute carrier family 22 (organic cation transporter), member 2, recombinant protein epitope signature tag (PrEST)

Sequence
ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR

Epitope
Binds to an epitope located within the peptide sequence KNAEAMRIIKHIAKK as determined by overlapping synthetic peptides.

Application

Monoclonal Anti-SLC22A2 antibody produced in mouse has been used in immunostaining.

Biochem/physiol Actions

Solute carrier family 22 member 2 (SLC22A2) is involved in the transport of cationic substances like drugs, toxins, waste metabolites like creatinine, neurotransmitters etc., from the kidney. Expression of SLC22A2 in kidney is regulated by methylation of the promoter region. The major substrate for SLC22A2 is metformin, an anti-diabetic agent. Lack of SLC22A2 leads possibly to drug toxicity as these substances are not eliminated from the body. Imipramine, clonidine, verapamil, quinidine, carvedilol, interact with SLC22A2 by hydrophobic interaction and leads to its inhibition.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86074

Physical form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

The two human organic cation transporter genes SLC22A1 and SLC22A2 are located on chromosome 6q26
Koehler MR, et al.
Cytogenetic and genome research, 79(3-4), 198-200 (1997)
Kidney-specific expression of human organic cation transporter 2 (OCT2/SLC22A2) is regulated by DNA methylation
Aoki M, et al.
American Journal of Physiology: Renal Physiology, 295(1), F165-F170 (2008)
Deficiency in the organic cation transporters 1 and 2 (Oct1/Oct2 (Slc22a1/Slc22a2)) in mice abolishes renal secretion of organic cations
Jonker JW, et al.
Molecular and Cellular Biology, 23(21), 7902-7908 (2003)
SLC22A2 is associated with tubular creatinine secretion and bias of estimated GFR in renal transplantation
Reznichenko A, et al.
Physiological Genomics, 45(6), 201-209 (2013)
Response to Comment on ?Epigenetic activation of the drug transporter OCT2 sensitizes renal cell carcinoma to oxaliplatin?
Zheng X, et al.
Science Translational Medicine, 9(391), eaam6298-eaam6298 (2017)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service