AMAB90791

Sigma-Aldrich

Monoclonal Anti-SLC22A2 antibody produced in mouse

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL0628, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(s):
OCT2

Quality Level

biological source

mouse

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

CL0628, monoclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

application(s)

immunohistochemistry: 1:200- 1:500

isotype

IgG1

conjugate

unconjugated

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... SLC22A2(6582)

General description

Solute carrier family 22 member 2 (SLC22A2) also known as organic cation transporter 2 (OCT2), is expressed prominently in the basolateral membrane of epithelial cells of kidney, especially in the proximal renal tubule. SLC22A2 possess 12 transmembrane domains and is the integral plasma membrane protein. In the human, SLC22A2 gene is mapped to chromosome 6q26.

Immunogen

solute carrier family 22 (organic cation transporter), member 2, recombinant protein epitope signature tag (PrEST)

Sequence
ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR

Epitope
Binds to an epitope located within the peptide sequence KNAEAMRIIKHIAKK as determined by overlapping synthetic peptides.

Application

Monoclonal Anti-SLC22A2 antibody produced in mouse has been used in immunostaining.

Biochem/physiol Actions

Solute carrier family 22 member 2 (SLC22A2) is involved in the transport of cationic substances like drugs, toxins, waste metabolites like creatinine, neurotransmitters etc., from the kidney. Expression of SLC22A2 in kidney is regulated by methylation of the promoter region. The major substrate for SLC22A2 is metformin, an anti-diabetic agent. Lack of SLC22A2 leads possibly to drug toxicity as these substances are not eliminated from the body. Imipramine, clonidine, verapamil, quinidine, carvedilol, interact with SLC22A2 by hydrophobic interaction and leads to its inhibition.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86074.

Physical form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
Interindividual differences in placental expression of the SLC22A2 (OCT2) gene: relationship to epigenetic variations in the 5?-upstream regulatory region
Saito J, et al.
Journal of Pharmaceutical Sciences, 100(9), 3875-3883 (2011)
Structural determinants of inhibitor interaction with the human organic cation transporter OCT2 (SLC22A2)
Zolk O, et al.
Naunyn-Schmiedeberg'S Archives of Pharmacology, 379(4), 337-348 (2009)
Response to Comment on ?Epigenetic activation of the drug transporter OCT2 sensitizes renal cell carcinoma to oxaliplatin?
Zheng X, et al.
Science Translational Medicine, 9(391), eaam6298-eaam6298 (2017)
Kidney-specific expression of human organic cation transporter 2 (OCT2/SLC22A2) is regulated by DNA methylation
Aoki M, et al.
American Journal of Physiology: Renal Physiology, 295(1), F165-F170 (2008)
The two human organic cation transporter genes SLC22A1 and SLC22A2 are located on chromosome 6q26
Koehler MR, et al.
Cytogenetic and genome research, 79(3-4), 198-200 (1997)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.