All Photos(6)

AMAB90863

Sigma-Aldrich

Monoclonal Anti-CDH1 antibody produced in mouse

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL1172, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(s):
Anti-UVO, Anti-uvomorulin, Anti-CD324
NACRES:
NA.41

Quality Level

biological source

mouse

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

CL1172, monoclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

enhanced validation

orthogonal RNAseq
RNAi knockdown
Learn more about Antibody Enhanced Validation

application(s)

immunoblotting: 1 μg/mL
immunohistochemistry: 1:1000- 1:2500

isotype

IgG1

immunogen sequence

ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... CDH1(999)

General description

CDH1 (cadherin 1) codes for a transmembrane glycoprotein E-cadherin that is located on human chromosome 16q22.1. It is a tumor suppressor gene, which is also known as Cdh1p/Hct1p, fizzy-related, Ste9 or Srw1.

Immunogen

cadherin 1, type 1, E-cadherin (epithelial)

Application

Monoclonal Anti-CDH1 Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/ Prestige.
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

CDH1 (cadherin 1) helps to conserve the homophilic cell-cell adhesion in epithelial tissues. Inadequate expression of CDH1 results in colon cancer and renal cell carcinoma (RCC).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86781.

Physical form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Peripheral location and infiltrative margin predict invasive features of papillary thyroid microcarcinoma.
Lee, et al.
European Journal of Endocrinology, 181, 139-149 (2020)
CDH1 promoter hypermethylation and E-cadherin protein expression in infiltrating breast cancer.
Caldeira JRF, et al.
BMC Cancer, 6(1), 48-48 (2006)
Reduced E-cadherin facilitates renal cell carcinoma progression by WNT/?-catenin signaling activation
Zhang X, et al.
Oncotarget, 8(12), 19566-19576 (2017)
Mitotic regulation of the APC activator proteins CDC20 and CDH1
Kramer ER, et al.
Molecular Biology of the Cell, 11(5), 1555-1569 (2000)
Identification of downstream metastasis-associated target genes regulated by LSD1 in colon cancer cells
Chen J, et al.
Oncotarget, 8(12), 19609-19630 (2017)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service