APREST72100

Sigma-Aldrich

PrEST Antigen PLBD2

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Synonym(s):
p76

Quality Level

recombinant

expressed in E. coli

assay

>80% (SDS-PAGE)

form

buffered aqueous solution

mol wt

predicted mol wt 31 kDa

purified by

immobilized metal affinity chromatography (IMAC)

concentration

≥0.5 mg/mL

immunogen sequence

GDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPFQWSTS

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... PLBD2(196463)

General description

Recombinant protein fragment of Human PLBD2 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Application

Suitable as a blocking agent using corresponding antibodies.

Linkage

Corresponding Antibody HPA017163.

Physical form

Solution in 1 M urea-PBS, pH 7.4

Preparation Note

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Germany

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.