APREST89977

Sigma-Aldrich

PrEST Antigen PHF8

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Synonym(s):
ZNF422, JHDM1F, KIAA1111
Pricing and availability is not currently available.

Quality Level

recombinant

expressed in E. coli

assay

>80% (SDS-PAGE)

form

buffered aqueous solution

mol wt

predicted mol wt 26 kDa

purified by

immobilized metal affinity chromatography (IMAC)

concentration

≥0.5 mg/mL

immunogen sequence

KATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGNGSGAGGILDLLKASRQ

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... PHF8(23133)

General description

Recombinant protein fragment of Human PHF8 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.    

Application

Blocking agent and positive assay control using corresponding antibodies.

Linkage

Corresponding Antibody HPA062015.

Physical form

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Preparation Note

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

RIDADR

NONH for all modes of transport

WGK Germany

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.