MilliporeSigma
All Photos(1)

APREST91115

Sigma-Aldrich

PrEST Antigen TNFRSF11A

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Synonym(s):
CD265, FEO, LOH18CR1, PDB2, RANK

recombinant

expressed in E. coli

Quality Level

assay

>80% (SDS-PAGE)

form

buffered aqueous solution

mol wt

predicted mol wt 34 kDa

purified by

immobilized metal affinity chromatography (IMAC)

concentration

≥0.5 mg/mL

immunogen sequence

CTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHV

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

General description

Recombinant protein fragment of Human TNFRSF11A with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.    

Application

Blocking agent and positive assay control using corresponding antibodies.

Linkage

Corresponding Antibody HPA047976.

Physical form

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Preparation Note

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service