All Photos(1)

APREST91703

Sigma-Aldrich

PrEST Antigen HM13

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Synonym(s):
H13, SPPL1, PSL3, IMP1, IMPAS, SPP, dJ324O17.1, PSENL3

Quality Level

recombinant

expressed in E. coli

assay

>80% (SDS-PAGE)

form

buffered aqueous solution

mol wt

predicted mol wt 22 kDa

purified by

immobilized metal affinity chromatography (IMAC)

concentration

≥0.5 mg/mL

immunogen sequence

KGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKEK

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... HM13(81502)

General description

Recombinant protein fragment of Human HM13 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.    

Application

Blocking agent and positive assay control using corresponding antibodies.

Linkage

Corresponding Antibody HPA056062.

Physical form

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Preparation Note

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service