- APREST92800
APREST92800
PrEST Antigen DDB1
Prestige Antigens™ Powered by Atlas Antibodies, buffered aqueous solution
Recommended Products
recombinant
expressed in E. coli
Quality Level
Assay
>80% (SDS-PAGE)
form
buffered aqueous solution
mol wt
predicted mol wt 30 kDa
purified by
immobilized metal affinity chromatography (IMAC)
concentration
≥0.5 mg/mL
immunogen sequence
LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFA
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... DDB1(1642)
Compare Similar Items
View Full Comparison1 of 4
This Item | APREST72511 | APREST77801 | APREST77802 |
|---|---|---|---|
| recombinant expressed in E. coli | recombinant expressed in E. coli | recombinant expressed in E. coli | recombinant expressed in E. coli |
| assay >80% (SDS-PAGE) | assay >80% (SDS-PAGE) | assay >80% (SDS-PAGE) | assay >80% (SDS-PAGE) |
| form buffered aqueous solution | form buffered aqueous solution | form buffered aqueous solution | form buffered aqueous solution |
| mol wt predicted mol wt 30 kDa | mol wt predicted mol wt 29 kDa | mol wt predicted mol wt 28 kDa | mol wt predicted mol wt 26 kDa |
| purified by immobilized metal affinity chromatography (IMAC) | purified by immobilized metal affinity chromatography (IMAC) | purified by immobilized metal affinity chromatography (IMAC) | purified by immobilized metal affinity chromatography (IMAC) |
| concentration ≥0.5 mg/mL | concentration ≥0.5 mg/mL | concentration ≥0.5 mg/mL | concentration ≥0.5 mg/mL |
General description
Application
Linkage
Physical form
Preparation Note
Legal Information
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 2
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificate of Analysis
Enter Lot Number to search for Certificate of Analysis (COA).
Certificate of Origin
Enter Lot Number to search for Certificate of Origin (COO).
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service