AV00001

Anti-CDK4 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-Cyclin-dependent kinase 4
• MDL number: MFCD00282839
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 34 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_000066
• UniProt accession no.: P11802
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CDK4(1019)

Description

General description

CDK4 is a Ser/Thr kinase that regulates G1 phase progression in cells. Alterations in CDK4 have been linked to several cancers. Rabbit Anti-CDK4 (AB1) antibody binds to dog, bovine, pig, rat, and human CDK4.

Immunogen

Synthetic peptide directed towards the C terminal region of human CDK4

Application

Rabbit Anti-CDK4 (AB1) antibody can be used for western blot assays at 1μg/ml.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable