All Photos(1)

AV06008

Sigma-Aldrich

Anti-AKT1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-v-akt murine thymoma viral oncogene homolog 1
NACRES:
NA.41

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

56 kDa

species reactivity

rat, mouse, human, dog

concentration

0.5 mg - 1 mg/mL

application(s)

immunohistochemistry: suitable
western blot: suitable

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... AKT1(207)

General description

Akt kinases participate in multiple signal transduction pathways and important cellular processes such as proliferation, survival, migration and angiogenesis.

Immunogen

Synthetic peptide directed towards the N terminal region of human AKT1

Application

Anti-AKT1 antibody is suitable for western blotting at a concentration of 0.25 μg/ml.

Biochem/physiol Actions

Although upregulation of Akt1 activity is rarely reported in cancers, mutations in Akt1 gene have been identified in many malignancies. Akt1 regulates homologous recombination and maintains genetic stability in breast cancer cells.

Sequence

Synthetic peptide located within the following region: RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Mitchell Cheung et al.
Current cancer drug targets, 13(3), 234-244 (2013-01-10)
AKT/PKB (Protein Kinase B) are central proteins mediating signals from receptor tyrosine kinases and phosphatidylinositol 3-kinase. AKT kinases are involved in a number of important cellular processes including cell proliferation and survival, cell size in response to nutrient availability, tumor...
Josée K Guirouilh-Barbat et al.
Oncotarget, 1(8), 691-699 (2011-02-16)
Endogenous replicative stress could be one trigger leading to tumor initiation: indeed, activation of the DNA damage response (DDR), considered the result of replicative stress, is observed in pre-cancerous cells; moreover, in hereditary breast cancers, almost all of the genes...
Hua-Yu Zhu et al.
PloS one, 9(5), e97114-e97114 (2014-05-13)
As an important oncogenic miRNA, microRNA-21 (miR-21) is associated with various malignant diseases. However, the precise biological function of miR-21 and its molecular mechanism in hypertrophic scar fibroblast cells has not been fully elucidated. Quantitative Real-Time PCR (qRT-PCR) analysis revealed...
Tetsuo Mashima et al.
Cancer research, 74(17), 4888-4897 (2014-06-26)
Endocrine therapy is the standard treatment for advanced prostate cancer; however, relapse occurs in most patients with few treatment options available after recurrence. To overcome this therapeutic hurdle, the identification of new molecular targets is a critical issue. The capability...
Xiaoyun Tang et al.
Journal of lipid research, 55(11), 2389-2400 (2014-09-12)
Lipid phosphate phosphatase-1 (LPP1) degrades lysophosphatidate (LPA) and attenuates receptor-mediated signaling. LPP1 expression is low in many cancer cells and tumors compared with normal tissues. It was hypothesized from studies with cultured cells that increasing LPP1 activity would decrease tumor...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service