AV100816

Anti-NR2F2 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-ARP1, Anti-COUP-TFII, Anti-COUPTFB, Anti-MGC117452, Anti-Nuclear receptor subfamily 2, group F, member 2, Anti-SVP40, Anti-TFCOUP2
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 45 kDa
• species reactivity: dog, pig, human, mouse, rabbit, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_066285
• UniProt accession no.: P24468
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... NR2F2(7026)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human NR2F2

Application

Anti-NR2F2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Packaging

100 μL

50 μg

Biochem/physiol Actions

NR2F2 is an orphan nuclear receptor that plays an important role in metabolism and development. The crosstalk between NR2F2 and the transcription factor HNF4α is involved in regulation of insulin secretion and maintenance of glucose homeostasis. NR2F2 collaborates with OCT4 and miR-302 in differentiation of human embryonic stem cells and specification of neural ectoderm during development.

Sequence

Synthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable