MilliporeSigma
All Photos(1)

Documents

AV30475

Sigma-Aldrich

Anti-BCL2L1 antibody produced in rabbit

IgG fraction of antiserum

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-BCL-XL/S, Anti-BCL2-like 1, Anti-BCL2L, Anti-BCLX, Anti-Bcl-X, Anti-Bcl-xL, Anti-Bcl-xS, Anti-DKFZp781P2092
MDL number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

26 kDa

species reactivity

sheep, rabbit, horse, pig, human, bovine, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BCL2L1(598)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
AV02008HPA035734SAB5701376
antibody form

IgG fraction of antiserum

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

-

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

-

Quality Level

100

Quality Level

100

Quality Level

100

Quality Level

100

species reactivity

sheep, rabbit, horse, pig, human, bovine, dog

species reactivity

canine, human

species reactivity

human

species reactivity

mouse, human

UniProt accession no.

Q07817

UniProt accession no.

Q07817

UniProt accession no.

Q07817

UniProt accession no.

Q9HB09

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

BCL2L1 is a signaling molecule that is known to regulate neuronal apoptosis. Furthermore, BCL2L1 can facilitate the survival of retinal ganglion cells.
Rabbit Anti-BCL2L1 associates with rabbit, rat, bovine, canine, pig, mouse, and human BCL2L1.

Immunogen

Synthetic peptide directed towards the N terminal region of human BCL2L1

Application

Rabbit Anti-BCL2L1 antibody can be used for western blot (2.5μg/ml) assays.

Biochem/physiol Actions

BCL2L1 encodes a protein which belongs to the BCL-2 protein family. The proteins encoded by BCL2L1 are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis.The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Two alternatively spliced transcript variants, which encode distinct isoforms, have been reported. The longer isoform acts as an apoptotic inhibitor and the shorter form acts as an apoptotic activator.

Sequence

Synthetic peptide located within the following region: SNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAING

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Joanna Janisiak et al.
International journal of molecular sciences, 22(15) (2021-08-08)
Rhabdomyosarcoma (RMS) is a malignant soft tissue cancer that develops mostly in children and young adults. With regard to histopathology, four rhabdomyosarcoma types are distinguishable: embryonal, alveolar, pleomorphic and spindle/sclerosing. Currently, increased amounts of evidence indicate that not only gene
Jeffrey M Harder et al.
Molecular and cellular neurosciences, 51(1-2), 53-59 (2012-07-28)
The Bcl-2 family is responsible for regulating cell death pathways in neurons during development, after injury and in disease. The activation of the pro-death family member BAX is often the final step before cell death in neurons. Pro-survival family members

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service