All Photos(2)



Anti-CEBPB antibody produced in rabbit

affinity isolated antibody

Anti-CCAAT/enhancer binding protein (C/EBP), β

biological source


Quality Level



antibody form

affinity isolated antibody

antibody product type

primary antibodies




buffered aqueous solution

mol wt

36 kDa

species reactivity

dog, guinea pig, human, bovine


0.5 mg - 1 mg/mL


western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.


Gene Information

human ... CEBPB(1051)

General description

CEBPB is a hepatic transcription factor that contains the basic leucine zipper (bZIP) domain. This transcription factor is known to interact with genes involved in acute phase response, metabolic activities, homeostatic functions, and the progression of cell cycle[1].
Rabbit Anti-CEBPB antibody binds to bovine, human, and pig CEBPB.


Synthetic peptide directed towards the C terminal region of human CEBPB


Rabbit Anti-CEBPB antibody can be used for western blot applications at 0.5μg/ml.

Biochem/physiol Actions

The protein encoded by this intronless gene, CEBPB, is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related proteins CEBP-alpha, CEBP-delta, and CEBP-gamma. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses and has been shown to bind to the IL-1 response element in the IL-6 gene, as well as to regulatory regions of several acute-phase and cytokine genes. In addition, the encoded protein can bind the promoter and upstream element and stimulate the expression of the collagen type I gene.


Synthetic peptide located within the following region: ADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids



Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service