AV31604

Anti-DLX2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-Distal-less homeobox 2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 34 kDa
• species reactivity: human, guinea pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_004396
• UniProt accession no.: Q07687
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... DLX2(1746)

Description

General description

Dlx2 is a homeobox gene that is involved in the patterning of branchial arches and dentition in mice.
Rabbit Anti-DLX2 (AB1) antibody recognizes canine, human, and mouse DLX2.

Immunogen

Synthetic peptide directed towards the N terminal region of human DLX2

Application

Rabbit Anti-DLX2 (AB1) antibody can be used for western blot (1.25μg/ml) and immunohistochemical (4-8μg/ml, using paraffin-embedded sections) applications.

Biochem/physiol Actions

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKP

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable