AV31839

Anti-PTF1A antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-Pancreas specific transcription factor, 1a
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 35 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_835455
• UniProt accession no.: Q7RTS3
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PTF1A(256297)

Description

General description

PTF1A is a part of the pancreas transcription factor 1 complex that regulates the expression of exocrine pancreas-specific genes. Ptf1a is required for GABAergic neuronal cell fates during spinal cord development. Furthermore, Ptf1a provides a link between the development of inhibitory and excitatory interneurons. Mutations in PTF1A have been associated with diabetes mellitus and cerebellar agenesis.
Rabbit Anti-PTF1A antibody recognizes canine, human, mouse, rat, and zebrafish PTF1A.

Immunogen

Synthetic peptide directed towards the N terminal region of human PTF1A

Application

Rabbit Anti-PTF1A antibody can be used for western blot application at a concentration of 2.5μg/ml.

Biochem/physiol Actions

PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas.

Sequence

Synthetic peptide located within the following region: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable