MilliporeSigma
All Photos(2)

AV31860

Sigma-Aldrich

Anti-MyCBP antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-c-Myc binding protein

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

12 kDa

species reactivity

guinea pig, human, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... MYCBP(26292)

General description

Rabbit polyclonal anti-MyCBP antibody reacts with human, mouse, rat, chicken, bovine, and canine c-Myc binding proteins.
c-Myc binding protein (MyCBP/AMY-1) binds the N-terminal region of myc and stimulates E box-dependent transcription of myc. MYCBP is up-regulated in colon carcinoma cells. MyCBP/AMY-1 is a trigger for erythrocyte differentiation. AMY-1 works as an inducer of human K562 cell differentiation upon induction of AraC.

Immunogen

Synthetic peptide directed towards the middle region of human MYCBP

Application

Rabbit Anti-EHF antibody can be used for western blot applications at a dilution of 1.25μg/ml. The product can also be used for IHC assays at 4-8μg/ml, using paraffin-embedded tissues.
Rabbit polyclonal anti-MyCBP antibody is used to tag c-Myc binding protein for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of c-myc binding protein in the regulation of myc expression and erythrocyte differentiation.

Biochem/physiol Actions

The MYCBP gene encodes a protein that binds to the N-terminal region of MYC and stimulates the activation of E box-dependent transcription by MYC.

Sequence

Synthetic peptide located within the following region: AATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service