MilliporeSigma
All Photos(3)

AV32212

Sigma-Aldrich

Anti-DLX2 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):
Anti-Distal-less homeobox 2, Anti-TES-1, Anti-TES1
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

27 kDa

species reactivity

bovine, rat, dog, mouse, guinea pig, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... DLX2(1746)

General description

Dlx2 is a homeobox gene that is involved in the patterning of branchial arches and dentition in mice.
Rabbit Anti-DLX2 (AB1) antibody recognizes canine, human, rat, bovine and mouse DLX2.

Immunogen

Synthetic peptide directed towards the C terminal region of human DLX2

Application

Rabbit Anti-DLX2 (AB2) antibody can be used for western blot assays at 2.5μg/ml. It can also be used for IHC at 4-8μg/ml using paraffin-embedded tissues.

Biochem/physiol Actions

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development.

Sequence

Synthetic peptide located within the following region: PASWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service